McDonnell Genome Institute

Washington University

CircRNA

chr1|55100838|55107430|-|USP24|ENST00000294383.6

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9931

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

7

Peptide

LEASEMEQLR

Amino Acids from 5' Exons

SLLSVDDDTDNPDDSVFYQVQSLFGHLMESKLQYYVPENFWK,HYFQWMMTQTIQMIACFTKCSLSLDIWKASCSTMYLRIFG,ITFSGHRQSRRVLPSAVSLWTFNGKQAAVLCTEFLE

Amino Acids from 3' Exons

LQKWSSGSAQLRCLKMRLLGWITLNLIVQLNVRPVKRTTSYWQGTYASSRPFFHSVGQKRKCL,FRNGAVKDQPSYDARDYLAGLTSYSMDQSGQHLTGRALTPHQDPSFTLWGRKGNA,SEMEQLRISPATMLEDEITWLDNFEPNRTAECETSEADNILLAGHLRLIKTLLSLCGAEKEML