McDonnell Genome Institute

Washington University

CircRNA

chr1|52445786|52481635|-|ZCCHC11|ENST00000257177.8

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9768

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

7

Peptide

EAIEGFDPK

Amino Acids from 5' Exons

PISSKHLSMEGNFLVPLFIHSLAEK,DQFHHESIYQWKETFWYPFLSTHWQRS,TNFIMKAFINGRKLFGTPFYPLIGREA

Amino Acids from 3' Exons

IEGFDPKRMDDFQLKGIVEEKFVKWECNSSSATEKNSIAEENKAKADQPKDDTKKTETDNQSNAMKEKHGK,LKALTQKEWMTFSRAKRSLSGNVIQVVQLRKTQLLRKTKLRQTNQKMIPRRQKQTTKVMPRKNMA,RLPKKNGLSAEGHSRREVCEVGMFKCNEKLNCGKQSGRPTKRYQEDRNRQPKCHEGKTWQ