McDonnell Genome Institute

Washington University

CircRNA

chr1|52436754|52493662|-|ZCCHC11|ENST00000257177.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9575

37

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

9

Peptide

GIAVWQMNHPDLLIK

Amino Acids from 5' Exons

QFTVTKEERQRREGRERRERFPRCSPPRPPRYSRLRPERPQMFYMWRCWTCTKGVPRGQAGPSEEQCG,SLLFRLKKKDSEEEKEGNEEEKDSRDVLDPRDLHDTRDFRDPRDLRCFICGDAGHVRRECPEVKLARQRNSSVA,VYCLDRRKTVKKRRKGMKKRKIPEMFLTPETSTILETLETRETSDVLYVEMLDMYEGSAQRSSWPVRGIAVWQ

Amino Acids from 3' Exons

MNHPDLLIKVLGILKKN,IIQIFKYLGFRKM,ESSRSSDKSTWDFKEK