McDonnell Genome Institute

Washington University

CircRNA

chr1|52436754|52446667|-|ZCCHC11|ENST00000257177.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.912

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

5

Peptide

GIAVWQIFDGK

Amino Acids from 5' Exons

QFTVTKEERQRREGRERRERFPRCSPPRPPRYSRLRPERPQMFYMWRCWTCTKGVPRGQAGPSEEQCG,SLLFRLKKKDSEEEKEGNEEEKDSRDVLDPRDLHDTRDFRDPRDLRCFICGDAGHVRRECPEVKLARQRNSSVA,VYCLDRRKTVKKRRKGMKKRKIPEMFLTPETSTILETLETRETSDVLYVEMLDMYEGSAQRSSWPVRGIAVWQ

Amino Acids from 3' Exons

IFDGKQIPQRMVDGWNAFFFDKTEEL,SLMENRFHREWLMDGMLSSLIKQKN,LWKTDSTENGWMECFLLNRRT