McDonnell Genome Institute

Washington University

CircRNA

chr1|52396045|52396364|-|ORC1|ENST00000371566.1

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9847

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

6

Peptide

RLELGSDTFSPK

Amino Acids from 5' Exons

VIPLAPKDVVPTNLKNEKTLFVKLSWNEKKFRPLSSELFAELNKPQESAAKCQKPVRAKSKSAESPSWTPAEHVAKRIESRHSASKSRQTPTHPLTPRARKRLELG,YLPQRMWYRRIKMRRHSLNYPGMRRNSGHFPQNYLRSINHKRVQPSARNPEPRVRVQRALLGPQQNMWPKGLNQGTPPPNLAKLLPILLPQEPERGWSLA,DTFSPKGCGTDESEKEDTLCETILEEEIQATFLRTICGVETTRECSQVPETRESQEECREPFLDPSRTCGQKDIKALRLQISPNSYPSSYPKSQKEAGAW

Amino Acids from 3' Exons

VIPLAPKDVVPTNLKNEKTLFVKLSWNEKKFRPLSSELFAELNKPQESAAKCQKPVRAKSKSAESPSWTPAEHVAKRIESRHSASKSRQTPTHPLTPRARKRLELG,YLPQRMWYRRIKMRRHSLNYPGMRRNSGHFPQNYLRSINHKRVQPSARNPEPRVRVQRALLGPQQNMWPKGLNQGTPPPNLAKLLPILLPQEPERGWSLA,DTFSPKGCGTDESEKEDTLCETILEEEIQATFLRTICGVETTRECSQVPETRESQEECREPFLDPSRTCGQKDIKALRLQISPNSYPSSYPKSQKEAGAW