McDonnell Genome Institute

Washington University

CircRNA

chr1|51403418|51409696|-|EPS15|ENST00000371730.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9069

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

8

Peptide

EDLQDEVQR

Amino Acids from 5' Exons

ARSSPELLPSGVTDENEVTTAVTEKVCSELDNNRHSKE,QEVVLNYCLLVLMKMRLQLLLKKFVLNSTIIDIQK,KKSTTAFWCDKGDYSCYKSLFTRQTFKR

Amino Acids from 3' Exons

DLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCAEEAQL,IFKMKFKGRILICKNYRPRNSRYRNSLMNWMSRKPSWRSNSRKSERNVLRRPN,SSRSSKGEYSAKTTGPETAGTGTPTGAESPAGGATQGSQKEMCGGPT