McDonnell Genome Institute

Washington University

CircRNA

chr1|51361170|51394447|-|EPS15|ENST00000371730.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.982

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

5

Peptide

EADPSNFANFSAVETLK

Amino Acids from 5' Exons

GKDPSTNWILLIPLNMIHFSLSQATIAPKKKILKYFVIHSLLLLPLPIKRLIQAILPTSV,EKIHQQIGFSSLTESISAFPRQRPQRKRSNILSIHFCYYHYQRGSKQFCQLQC,KRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSA

Amino Acids from 3' Exons

VETLKHNDPFAPGGTVVAASDS,KRSTMILLLLVEQLLQQAIQ,RNVEAQSFCSWWNSCCSKRF