McDonnell Genome Institute

Washington University

CircRNA

chr1|50475463|50801677|-|FAF1|ENST00000371778.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9905

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

15

Peptide

RDAAINGVIPQENGILQ

Amino Acids from 5' Exons

AIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRD,PSGCPSKPCLLSQRKKMLSLANCGSGPPVASSWSGVSWPATSSRLSLILLPKDFHGMSTSYAPFLGE,HPAVLRASPASAKGRKCACEQTADPDPQWRVLGAAFPGQQQAPDCLFCSFQRISMGVQVTEHLSER

Amino Acids from 3' Exons

AAINGVIPQENGILQ,QLSMVYHRKMAFYK,SYQWCNTTGKWHSTK