McDonnell Genome Institute

Washington University

CircRNA

chr1|47368468|47373107|+|CMPK1|ENST00000371871.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9311

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

14

Peptide

ADVSFVLFFDCNNEK

Amino Acids from 5' Exons

KYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKR,NMATHTFLQESCFVMKGRTQIHSMVNLLKSTLKKERLYQLRPSVYR,IWLHTPFCRRAASKEEPRFTVWTYKVHRRKDCTSDNHQFIKE

Amino Acids from 3' Exons

EMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNE,KWIRQWLPMLRRINSLMGFQEIKTTFKDGTRPWMGRQMYLSFSFLTVIM,NGSDNGCQCSEEILDWVSKKSRQPSRMEQDHGWEGRCIFRSLFL