McDonnell Genome Institute

Washington University

CircRNA

chr1|47280240|47301748|-|STIL|ENST00000337817.9

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9993

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

LLQAQMK

Amino Acids from 5' Exons

ISKIQPSVPELSLVLDGNFIESNPLPTPLEMVNNENPPLINHLEHLKPLQPQLYDEKHSPEVEAGEPSLRGIPNQLNQDKPALLRHCKVRQPPAYKKGNPHTRNSIKPSSHNGPSHDIFEKLQTVSAGNVQNEEYPIRPSTLNSRQSSLAPQSQPHDFVFSPHNSGRPMELQIPTPPLPSYCSTNVCRCCQHHSHIQYSPLNSWQGANTVGSIQDVQSEALQKHSLFHPSGCPALYCNAFCSSSSPIALRPQGDMGSCSPHSNIEPSPVARPPSHMDLCNPQPCTVCMHTPKTESDNGMMGLSPDAYRFLTEQDRQLRLLQAQ,FLRSNHQFLNFHLCWMAISNQTLCLLHWKWIMKILLLTTWNTSHCNPSFMMRNTVQKLKLESLPEEYQISTRINQLFDTAKDSHLPIRKGTPIPGTVLNHLLIMGHLMIYLKSSKQFLLEMYKTKSILDPPHLILGSLLLPRSPNHTILFFHPIIQEDQWNFRYLLPHCHLTVPQTFAGVVSIIVIFNIVRILGKEQTQLDPFKMSSLKPFKSIHYFTQVDVQPCTVMHSVLQVVLPDLREIWAVVLPTAILNHRLWQDRLHIWTYVTHSLAQCACTHPRLSQIMEWDYLQMHIGSSQNKTDSDYFRH,FDPTISSTFTCVGWQFHRIKPSAYSIGNGEKSSFDPLGTLEAIATPALETQSRSSWRAFLERNTKSVKPGTSSFETLQSKTATCLEREPPYQEQYTIFSWAISYIKAPNSFCWKCTKRRVSYKTLHTFAVFSCPAVPTTRFCFFTPFRKTNGTSDTYSPTAILLFHKRLQVLSASSYSISAKFLARSKHSWIHSRCPVSPSKAFIISPKWMSSPVLCILFFKSYSLETSGRYGQLFSPQQYTIACGKTAFTYGLMPTALHSVHAHTQDVRWNDGTISRCISVPHRTRQTAKTTSGT

Amino Acids from 3' Exons

MKKVHQIALILVEKYLNAKPLLLLFLGTFFHAKFILKNFVQEKFTVMTSVQL,RRCNIDSRSLSWSRSTMPRNNPYCFSSWGLFDSMQSSYSRTLFKRNDSSQCRLQFSFK,EEGVTLTVDRFDPGREVPECLEITPTASLPGDFLIPCKVHTQELCSREMIVHSVDDFSSALK