McDonnell Genome Institute

Washington University

CircRNA

chr1|46055794|46077613|-|PIK3R3|ENST00000262741.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9939

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

6

Peptide

DQHLVEEVNDK

Amino Acids from 5' Exons

NYDELIEITSGDSQNASRAGFEESSFGQPRNRKNEHQTPDPAAKDPRSTPC,IMMNYDKLKSRLGEIHDSKMRLEQDLKNQALDNREIDKKMNSIKPDLIQLRKIRDQHL,LIMINNHVWVRFMIAKCVSRIRIKLWTTEKIKKIASNLTSSCERSEINTL

Amino Acids from 3' Exons

GGGKQIAGYARWDLLGPRCLNKNAGRLYFDFA,EEVNDKLRDMPDGTFLVRDASTKMQGDYTLTL,RRMTNCGICQMGPSWSEMPQQKCREIILLC