McDonnell Genome Institute

Washington University

CircRNA

chr1|45013908|45014836|+|UROD|ENST00000494399.5

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9387

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

20

Peptide

LDSGPKESPWTLMTYMVEGGGSSTMAQAK

Amino Acids from 5' Exons

WTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQVSPERERNRLGFGLGPEARVSTEGRGLNARDERTLASSDLAEQPSPSHQWGLMLVFRHQSCWDLRKVNFFFFNYWVFRVRQYQGLKSFGENGGFCMWGKLPLCVLHIFLHHTLTRHCSCLSPMQGILAHSSSTSLHCLTSVMWPSKRPGCGRQAWHQCPWGLGWVERWSCGAFRLSPAWTGVTTGGQQKYSQERLVVVARPSVADLLFSRSSLLRMGILPWRSWPKLAMRWLGLTGQWPQRKP,GPHTWLRVVAQAPWLRPSAGSIRDLRLVTSCFASSLMLWSHIWDKWWLVPRVLREREIGWDLVCKDQKQECPKPERAGVLMPGMKEPWPPVIRSSQAHPDTDSGACSKYSDTKVSAGIGKIFFFLITGFLGSGSIRDSHLGKIEVDFVCGGNFLFVCYIFFFTIPLGIAAVVPCRASWPTALQQVCTALHPCGQASEGQVAGGRPGTSAHGEDWDGLSEGGPVELSGVLHGLEPLEGSRSTVKKDWLQGPLPEICFFLDHLCGWAFCPGGAGPSWLGGWALDSGPKESP,DPDDIHGGWWLKHHGSGQALALSETSGSPAASHPHCSGPISGRTSGGWCPGESEREKAGIWSVRTRSKSVLNLRGQGSCQGKNLGLQSSGAAKPILTLTVGLNALSIQTPKLVLGSEESKFFFFLLGFGQAVSGIEVIWGKLRWILYVGETSSLCVTYFSSPYPNALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMVRIGMGVKVVLWSFQAKSCMDWSDHWRAAEVQSRKISGCSKALCSLRSAFFIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKA

Amino Acids from 3' Exons

WTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQVSPERERNRLGFGLGPEARVSTEGRGLNARDERTLASSDLAEQPSPSHQWGLMLVFRHQSCWDLRKVNFFFFNYWVFRVRQYQGLKSFGENGGFCMWGKLPLCVLHIFLHHTLTRHCSCLSPMQGILAHSSSTSLHCLTSVMWPSKRPGCGRQAWHQCPWGLGWVERWSCGAFRLSPAWTGVTTGGQQKYSQERLVVVARPSVADLLFSRSSLLRMGILPWRSWPKLAMRWLGLTGQWPQRKP,GPHTWLRVVAQAPWLRPSAGSIRDLRLVTSCFASSLMLWSHIWDKWWLVPRVLREREIGWDLVCKDQKQECPKPERAGVLMPGMKEPWPPVIRSSQAHPDTDSGACSKYSDTKVSAGIGKIFFFLITGFLGSGSIRDSHLGKIEVDFVCGGNFLFVCYIFFFTIPLGIAAVVPCRASWPTALQQVCTALHPCGQASEGQVAGGRPGTSAHGEDWDGLSEGGPVELSGVLHGLEPLEGSRSTVKKDWLQGPLPEICFFLDHLCGWAFCPGGAGPSWLGGWALDSGPKESP,DPDDIHGGWWLKHHGSGQALALSETSGSPAASHPHCSGPISGRTSGGWCPGESEREKAGIWSVRTRSKSVLNLRGQGSCQGKNLGLQSSGAAKPILTLTVGLNALSIQTPKLVLGSEESKFFFFLLGFGQAVSGIEVIWGKLRWILYVGETSSLCVTYFSSPYPNALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMVRIGMGVKVVLWSFQAKSCMDWSDHWRAAEVQSRKISGCSKALCSLRSAFFIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKA