McDonnell Genome Institute

Washington University

CircRNA

chr1|44635544|44636162|+|RNF220|ENST00000335497.11

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

HVEHCLSK

Amino Acids from 5' Exons

LGLGKNGGSKMKGRYVPCATAPWQDRSRRVGMWSIAFL,SDWENETEEARRAGMSPVQPPPGRIGAGDEACGALPF,RIGKMKRRKQDEGQVCPLCNRPLAGSEQEMSRHVEHCLSK

Amino Acids from 3' Exons

REGSCMAEDDAVDIEHENNNRFEEYEWCGQKRIRATTLLEGGFR,GKAPAWLRMMLWTSSMRTTTALRSMSGVDRSGYGPPLSWKVASE,GRLLHGGCCGHRAEQQPLGVVVWTEADTGHHSPGRWLP