McDonnell Genome Institute

Washington University

CircRNA

chr1|43603415|43604189|+|PTPRF|ENST00000429895.5

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9946

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

SAHGPAK

Amino Acids from 5' Exons

ETTISGLTPETTYSVTVAAYTTKGDGARSKPKIVTTT,KPLSAAPRRPPTPLLLLPIPPRGMVPAASPKLSLQQ,NHYQRPDPGDHLLRYCCCLYHQGGWCPQQAQNCHYN

Amino Acids from 3' Exons

SQAGPPSAPRPTLRCSSGTHPRNCLASCWATGCSTAGPTRRGPTPISARMTSTSQSPACTRGPPTSSGLLPRTGLAWVRSSRRRSGPPRTCPAASPKTCMQDPRLPQNWPGTRQCWRRGTGASSATPWCSETSTANRSCRTSRQTPALPLLASSQTPLTTSRSAHGPAKALAHSAPASSPGPCRWSK,PRPAHHDDQHHGHEHCAAPVAPTQGTAWRAAGLPAAVLPGRRGAAQHHRFRQGPALHSHRPAQGDHLHLPACCQEPGWLGGVREGDQDPRGPAQRLPPKPACDRTDHVYHRTGLGPASAGGEERAHHQLHRGVPRHQQPTGAAEHHDRHPLYPYWPQARHHLRHQGPRMDQQRLWPTQPQHPVPDHAGGA,PGRPTMMISTTAMNTALLQWHPPKELPGELLGYRLQYCRADEARPNTIDFGKDDQHFTVTGLHKGTTYIFRLAAKNRAGLGEEFEKEIRTPEDLPSGFPQNLHVTGLTTSTTELAWDPPVLAERNGRIISYTVVFRDINSQQELQNITTDTRFTLTGLKPDTTYDIKVRAWTSKGSGPLSPSIQSRTMPVEQ