McDonnell Genome Institute

Washington University

CircRNA

chr1|43597747|43598913|+|PTPRF|ENST00000359947.8

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9838

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

20

3

Peptide

TAGGMWWMASAVSTPAGTWWAWR

Amino Acids from 5' Exons

PPPPLPRRCVAWAPPRSGVGSRRLPTAATALSPSTPWPTRRWTARTAGGMWWMASAVSTPAGTWWAWRSGRSTGCGCGHTQTWAPAPRAARCWCAPMRT,PLRPSPEGDVCEHGLHHGPGKLGPAACRQPQRRYHPVLRGLRGGGRRGPRAACGGWHQPALQLGPGGPGEVDGVPGVGAGTHRRGPRPREQPGAGAHRG,PSAPPQKVMCVSMGSTTVRVSWVPPPADSRNGVITQYSVAYEAVDGEDRGRHVVDGISREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDED

Amino Acids from 3' Exons

CPAGLRGRWRWSHTPLLCMSTGSCLSPASSMARSAATRSPTCGWRMASPVDSPSSKTSCPRP,AQRASAEGGGGATELHCCACLLEAACPQQAAWPDPRLPGHLRAAGEWRAPWTPHHPRRHASRGP,PSGPPRKVEVEPLNSTAVHVYWKLPVPSKQHGQIRGYQVTYVRLENGEPRGLPIIQDVMLAEAQ