McDonnell Genome Institute

Washington University

CircRNA

chr1|43590971|43592601|+|PTPRF|ENST00000359947.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.926

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

TGALQPTAPR

Amino Acids from 5' Exons

LFQSLRLILWQRQLPPVSPSPGTLGTRSLPTMASSTAQRARRAPFRRWMVWPPPATALAASALSRNMPSACWRTASGEGRPARQCGHARENRRPPAHRAACRHACAPAPCWCSGSLPRSPTAWCGDTASTILRTPAAPRTPGTSTTPTRGSSRPWAACCLASPTACACLPSPPWAMALPAPPSRSRRSRE,SSKASDSCGDRDNCHQCHPHLGLWELGACNLLWHPVPRSGHGGPLSGGGWCGHHPLQHWRPQPFLGICLPRAGGEQHRARAAQRGSAGTHGRTGALQPTAPRAGTHAERQHHAGAVGASRGAQRPGAGIPRLLYSGLPPPPERLAQAQHRRGAPHDRGQPAAWHHLQPARACLHRRGRWPSQPHHPGQDAAG,LPKPPIDLVVTETTATSVTLTWDSGNSEPVTYYGIQYRAAGTEGPFQEVDGVATTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRVQARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPPNAWHKHNTDAGLLTTVGSLLPGITYSLRVLAFTAVGDGPPSPTIQVKTQQG

Amino Acids from 3' Exons

HKVTFDPTSSYTLEDLKPDTLYRFQLAARSDMGVGVFTPTIEARTAQS,TRPSTQPPPTHRTSLTHSTASSWLHARIWGWASSPPPLRPAQPSP,QGDLRPNLLLHTRGPEAHTLPLPAGCTLGYGGGRLHPHHGPHSPV