McDonnell Genome Institute

Washington University

CircRNA

chr1|43364927|43365376|-|ELOVL1|ENST00000496932.1

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9285

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

GSDPCPQLAK

Amino Acids from 5' Exons

IPGSRATLWGPPCPPFSPTCTSFSHLGLASWLIGSPSSSVASLSTTSHWWHSPSTLSMRWAPGMPGFNFCQQDKEQAIEPEHGISPFQRGSDPCPQLAKGRDGWEGRTLVVSTSLPSSCRAGAPIPGAVTLWTIPTALRHL,SPDPGLPSDGVPLANDLHSPDLRVLRSLTWASHHGSEALPAPWLHDCLQLLTGGTLPLHCLGGPLGCRALISVSRIRSRPSQSMAFLLSREVQIHVLSRRGGMAGKGELWWSNPHPFPVPDVGLAEHLYLALPCGLFQQPGT,PRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLVALSLYIVYEVGPWDAGLFLSAGGAGHRARAWHFSFPERFRSMSSASEGEGWLGRENSGGLIHIPSQFLMSGWLSTYTWRCDPVDYSNSPEALR

Amino Acids from 3' Exons

IPGSRATLWGPPCPPFSPTCTSFSHLGLASWLIGSPSSSVASLSTTSHWWHSPSTLSMRWAPGMPGFNFCQQDKEQAIEPEHGISPFQRGSDPCPQLAKGRDGWEGRTLVVSTSLPSSCRAGAPIPGAVTLWTIPTALRHL,SPDPGLPSDGVPLANDLHSPDLRVLRSLTWASHHGSEALPAPWLHDCLQLLTGGTLPLHCLGGPLGCRALISVSRIRSRPSQSMAFLLSREVQIHVLSRRGGMAGKGELWWSNPHPFPVPDVGLAEHLYLALPCGLFQQPGT,PRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLVALSLYIVYEVGPWDAGLFLSAGGAGHRARAWHFSFPERFRSMSSASEGEGWLGRENSGGLIHIPSQFLMSGWLSTYTWRCDPVDYSNSPEALR