McDonnell Genome Institute

Washington University

CircRNA

chr1|42754868|42755217|-|P3H1|ENST00000460031.5

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9109

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

5

Peptide

EGFMDSR

Amino Acids from 5' Exons

DSWTPEEVIPKRLQEKQKGPRNCMVGSVSTGFLSPGRCELLARGGQVQFGKSGWSPGLALECSPQSGCAHRSERETAVRISQEIGNLMKEIETLVEEKTKESLDVSRLTRE,IHGLQKKFPRDCKRNRSEDLEETAWLDQSDEALEASAQADVNSWQGVGRSSLGSRGGAQGWPWNAVLRAAVLIGQNGKQPYASPRRLGTLRKSRPLWKRRPRSHWMADPGK,FMDSRRSDSQEIARETEVRTLKKLHGWISLMKHLRLPEPRQMTPGKGWAGPVWEVGVEPRAGPGMQSSERLCSVRTGNSRTHLPGDWEPYEGNRDPCGREDQGVTGCEQTDPG

Amino Acids from 3' Exons

DSWTPEEVIPKRLQEKQKGPRNCMVGSVSTGFLSPGRCELLARGGQVQFGKSGWSPGLALECSPQSGCAHRSERETAVRISQEIGNLMKEIETLVEEKTKESLDVSRLTRE,IHGLQKKFPRDCKRNRSEDLEETAWLDQSDEALEASAQADVNSWQGVGRSSLGSRGGAQGWPWNAVLRAAVLIGQNGKQPYASPRRLGTLRKSRPLWKRRPRSHWMADPGK,FMDSRRSDSQEIARETEVRTLKKLHGWISLMKHLRLPEPRQMTPGKGWAGPVWEVGVEPRAGPGMQSSERLCSVRTGNSRTHLPGDWEPYEGNRDPCGREDQGVTGCEQTDPG