McDonnell Genome Institute

Washington University

CircRNA

chr1|41142877|41151684|-|SCMH1|ENST00000326197.11

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9977

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

6

Peptide

NGGMLQPPLGHFTWDK

Amino Acids from 5' Exons

SYTPPSNEFKISMKLEAQDPRNTTSTCIATVVGLTGARLRLRLDGSDNKNDFWRLVDSAEIQPIGNCEKNGGMLQPPL,PTHLQATSSRSVNWKHRTPGTPHPPVLPQLDQVPAFACALMGATTKMTSGGWLTQLKSSLLGTVKRMGVCYSHLL,LHTSKQRVQDQYEIGSTGPQEHHIHLYCHSSWTDRCPPSPAPWERQQKLLAAGLSNPAYWELKEWGYATATS

Amino Acids from 3' Exons

VILPGTNTKKHVQSQRLSIASS,SFYLGQIPKRNMFSPSACPLLQA,HFTWDKYLKETCSVPAPVHCFKQ