McDonnell Genome Institute

Washington University

CircRNA

chr1|40222573|40231658|+|RLF|ENST00000372771.4

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9099

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

VIQTEIAK

Amino Acids from 5' Exons

IAKVDCKEVLDIICNLESEGQDNTAFVLCTTYLTQQLQTASVYCS,LQRSTARKYTSFVIWNLRGRITQHLFFVRLTLPSSSKLQVYIVL,CKGRLQGSTRHHLSGIGAGHSICSLYDLPYPAAPNCKCILFL

Amino Acids from 3' Exons

GTDSFLETAKKNPFFRYFFGALSSVWCHSNAAAFILPHSYTN,ELTLFWSKLQRRIDPSLDTFLERCRQFGVIAKTQQHLFCLIRVIQTE,NLFFGVNCKEELTLLILFWSAVVSLVSLKRSSIYFASLELYKL