McDonnell Genome Institute

Washington University

CircRNA

chr1|40069689|40070282|+|CAP1|ENST00000340450.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9852

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

6

Peptide

INSITVALK

Amino Acids from 5' Exons

PNMYLMTRLTRTLPRLRVVQYAVAPNHSLHLNPKPAHPPNEPQRRSQLYLNWRARSGE,PETCIHEDSQEPCPEGSEWSSTQWPQTILCTTPNQPIPQTSHKEGASCTTGGQEVES,LKHVSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRV

Amino Acids from 3' Exons

ENQENVSNLVIEDTELKQVAYIYKCVNTTLQIKGKINSITV,KIRKMFPTWLRTQSNRWLTYTSVSTRHCKSRAKLTPLQ,KSGKCFQPGDGHRAETGGLHIQVCQHDIANQGQNLHYS