McDonnell Genome Institute

Washington University

CircRNA

chr1|39452155|39459249|+|MACF1|ENST00000289893.8

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9741

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

LEEVFQK

Amino Acids from 5' Exons

VFQKELGKRTGTVQVLKRSGRELIENSRDDTTWVKGQLQELSTRWDTVCKLSVSKQSRLEQALKQ,FSRRNWESEQEPFRSSGQAESLRIVEMTPLGKDSSRNALAGTLSVNSLFPNKAGLSRPN,FPEGTGKANRNRSGPEAVRPRADESRHHLGKRTAPGTEHSLGHCLTLCFQTKPAAGLKT

Amino Acids from 3' Exons

GNPVSQPLLPCQSFHSLKQKTHGSTSFLPAGSRCGCHWSGKGNMMPWIGWR,EIPKSANPSSHANPFTVSKKPTDQPAFCPLAAGVAVSTGAAKETECLGSAGG,KSLSQPTPPPMPILSQSEAKNPRINQLSARWQQVWLLALERQRKLNDALDRLEE