McDonnell Genome Institute

Washington University

CircRNA

chr1|39427960|39432654|+|MACF1|ENST00000289893.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

56

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

2

Peptide

ALEEDIENHATDVHQAVK

Amino Acids from 5' Exons

ALEEDIENHATDVHQAVKIGQSLSSLTSPAEQGVLSEKIDSLQARYSEIQDRCCRKAALLDQALSNARLFGEDEVEVLNWLAEVEDKLSSVFVKDFKQDVLHRQHADHL,LWKKTKTMQQMCTRQSKLGSPSPPHLLQNRVCCQKRTHCRPDTVKFKTAVVGRQPYLTKLCLMLGCLGRMRWRCSTGWLRLRTSSVQCSRISNRMSCTGSMLTT,SGRRHRKPCNRCAPGSQNWAVPLLPDISCRTGCAVRKDRLIAGPIQNSRPLLSEGSPTPSSVCAVWGGGGGAQLAGGGQAQFSVRKGFQTGCPAQAACPP

Amino Acids from 3' Exons

YEQAADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQK,MSKLPMQNLGLLKQNGNWLWVQFAWNRTRPQLSFRYR,ASCRCRTSLGCNKTETDGSGSNSPGTGPDHSSASGTE