McDonnell Genome Institute

Washington University

CircRNA

chr1|39422373|39439500|+|MACF1|ENST00000289893.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9379

34

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

7

Peptide

QQVEAAEMFQK

Amino Acids from 5' Exons

MFQKEQVDPLQMKLQQVNGLGQGLIQSAGKDCDVQGLEHDMEEINARWNTLNKK,CFRKNKWILFRNCSRMDLARDFRVQEKTVMYRVNMTWKRSMLDGIHIK,VSERTSGSSSDEIAAGEWTWPGINSECRKRLCTGFRTHGRDQCSMEYIEK

Amino Acids from 3' Exons

KSRINWIKWYSSGRTSKLGLKNEKSNFLMSLNQRSSGMTWQLSPPSKTPRILSMTWKAQALILPSSNNRLKLL,NPGIGSNGILLGGHQSSGRTRNQISCPISREVLVHGSSPDHHQRHPGYCPLGKPRHSFHHQTTGSC,IQDKLDQMVFFWEDIKARAEEREIKFLDVLELAEKFWYDMAALLTTIKDTQDIVHDLESPGIDPSIIKQQVEAAE