McDonnell Genome Institute

Washington University

CircRNA

chr1|39380243|39382152|+|MACF1|ENST00000289893.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.928

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

4

Peptide

QQVQAFLAELEQNSPK

Amino Acids from 5' Exons

AFLAELEQNSPKIQKVKEALAGLLVTYPNSQEAENWKKIQEEL,PSWLSWNRILQKFKKRKPWLDYWHIPTHRKQKIGRKFRKNS,LPGVGTEFSKNSKSKGSPGWITGDISQLTGSRKLEENSGRT

Amino Acids from 3' Exons

IPDGKGPLRLLWLGKGSRNLQVIWPASRLQNPSSGRGWRKNWECWGPCLLTPTCMHKSNRS,FPMGKGHGYCGSAKAARGICKSSGLLPGCRIPAPAVADGERTDDGSAGAPVYPQHVECTKATGP,SRWERATEVTVARQRQLEESASHLACFQAAESQLRPWLMEKELMMGVLGPLSIDPNMLNAQKQQVQ