McDonnell Genome Institute

Washington University

CircRNA

chr1|39315512|39323008|+|MACF1|ENST00000361689.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9025

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

6

Peptide

RLEEEEHTQEDLQQLR

Amino Acids from 5' Exons

HTQEDLQQLRSDLDAVSMKCDSFLHQSPSSSSVPTLRSELNLLVEKMDHVYGLSTVYLN,TPRRIYSNGQTWMQFLNVTAFSISLHLVQVSQLCAQNICWWRRWTMSMVSLLYII,HPGGFTAIEVRLGCSFYEMQLSPSVSIFKCPNSALRTESAGGEDGPCLWSLYCISE

Amino Acids from 3' Exons

FMDLRTRYTALVTLTTQHVKYISDALRRLEEEE,SWTGLATRHWLQLSTNTSVMHSGVWRRR,HGLKDSLHGIGDFNNSAREIHQCTPASGGGG