McDonnell Genome Institute

Washington University

CircRNA

chr1|3833861|3835092|-|CEP104|ENST00000378230.7

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9534

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

7

Peptide

VTAANFIQVAEAYCK

Amino Acids from 5' Exons

VFQASLKLLKMIITQYIPKHKLSKLETAHCVERTIPVLLTRTGDSSARLRVTAANFIQ,FFRLLNCKSLHNIFLNINVNLKQLTVWRGPFPFCSPELEILLPASASQLQILF,FSGFFEIVENDHYTIYSTTETNSSLCGEDHSRFAHQNWRFFCPPPRHSCKFYS

Amino Acids from 3' Exons

VAEAYCKTWSYREDALLALSKKLMEMPVGTPKEDLKNTLRASVFLVRRAIKDIVTS,LLRPIVRRGPTERMHCLPCLRSWKCLLEPQKKIRTHEHPSFSLEEPRTLP,CGLLDVVLPRGCTACLVEVNGNACWNPKRRFKEHTESIRLSRKSHKGHCDL