McDonnell Genome Institute

Washington University

CircRNA

chr1|3781511|3787310|-|LRRC47|ENST00000378251.2

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

23

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

21

Peptide

DVMDALILTLDLSNNQLSEIPAELADCPK

Amino Acids from 5' Exons

VKKTTSDLFLEVTSATSLQICKDVMDALIL,LRKRLLICFWKQVPPVCRFARMSWMPSF,ENDFFVFGSNKCHQSADLQGCHGCPHS

Amino Acids from 3' Exons

TLDLSNNQLSEIPAELADCPKLKEINFRGNKLRDKRLEKMVSGCQTRSILEYLRVGGRGGGKGKGRAEGSEKEESRRKRRERKQRREGGDGEEQDVGDAGRLLLRVLHVSENPVPLTVRVSPEVRDVRPYIVGAVVRGMDLQPGNALKRFLTSQ,RWTSRTTSARSLQSLRTAPSSRRSISVGTSGTSAWRRWSAAARPDPSWSTCASEAVVAGRARAVPRARRRKRAGGRGGRGSRGGKVVMGRSRTWEMPAGCCSGSCTSLKTPYLQSEAPRSGMCGPTLWGPWCEAWTCSQGMHSSASSPR,VGPLEQPAERDPCRACGLPQAQGDQFPWEQAEGQAPGEDGQRLPDQIHPGVPARRRPWWREGQGPCRGLGEGREPEEEEGEEAEAGRWWGGAGRGRCRPAAAQGPARLKPRTSDSQSEPRGPGCAALHCGGRGARHGPAARECTQALPHLA