McDonnell Genome Institute

Washington University

CircRNA

chr1|36027113|36040441|+|AGO3|ENST00000246314.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

1

Peptide

GGFTDQLR

Amino Acids from 5' Exons

GFHRPAADFGCRDAHPGPAMLLQICTGGRQRRAHVPASQEHIFWPTAYYRHPAGEDTSV,GFTDQLRKISKDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVY,VSQTSCVRFLRMQGCPSRASHASANMHRGQTASPCSGISRTHILAYSLLSSSCRGRHQCM

Amino Acids from 3' Exons

VLYYELLAIREACISLEKDYQPGITYIVVQKRHHTRLFCADRTER,YYIMNYQFEKPASVWRKTINLEPTLFRRDITLDYFVLIGQK,IILTTSNSRSLHQFGERLSTWNNLHCSSEETSHSIILCDRK