McDonnell Genome Institute

Washington University

CircRNA

chr1|35456012|35466695|-|KIAA0319L|ENST00000325722.7

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9701

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

9

Peptide

VVEMQLTPGLYEFK

Amino Acids from 5' Exons

LDCSRLWSYQLYYCKPDSEQSCGLPPCGQRRPQPSDHPAPKLHHPLWEPEHSWHHQLVVTQPKQQRESGGDA,LTVVDSDGATNSTTANLTVNKAVDYPPVANAGPNQVITLPQNSITLFGNQSTDDHGITSYEWSLSPSSKGKVVEMQ,LTLMELPTLLLQTQTKLWITPLWPTQAPTKSPCPKTPSPSLGTRALMIMASPAMSGHSAQAAKGKWWRC

Amino Acids from 3' Exons

LTPGLYEFKVIVEGQNAHGEGYVNVTVKP,SLQACMNSKLRVKMPMGKAMTQSSQ,HSRPVIQSDCRGSKCPWGRLCERDSQA