McDonnell Genome Institute

Washington University

CircRNA

chr1|35451627|35507135|-|KIAA0319L|ENST00000325722.7

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9281

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

5

Peptide

EDASESR

Amino Acids from 5' Exons

GTWGAARECQQCCYCDWAASGDLCVHLDCQREEPAKPELCECHCQR,GPDGVQLENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSVNVIVKE,DLMGCSSRMLTAVLLLLGCKWGPMCSPLSKMRGTCKARALMSLSKK

Amino Acids from 3' Exons

MPVRAGASRGRHNLELADLGEKITSGFLKEPPLSSHVGLPAARTLPAMSFGGKGCAFRQTAAGPRAAGLLGHTPPIPCWCFKNSKLQMIWAFYLKMMYHIFWGVGTGHLGGRAHPELHSDLLYLPVTSRASGSFRREVVPVTLHLHSILKMTPTNVVLPVALQ,CQEQVPAGEDTIWSWPEIWGRKSPLASRNPLSPVMLGCLLPGLCLPCLLVARRDVHSGRLQQAPELPGFDTLLQFHAGVFKKIPNCRFGLSTRCTTSSGARLELGILEAEPTQSCTQTCCIFQPAELNQEASEERSQRSYTYSDTAFSELQRIRWSDYQWLCR,ASESRCQQGKTQFGVGLRSGGENHLWLLEGTPSLQSCWAACCQDSACHVFWWLEGMCIQADCSRPQSCRAFRTHSSNSMLVFLKKFQTADDLGFLPEDDVPHLLGLGWNWASWRQSPPRAALRPAVSSSDQQSLIRKLQKRGSPSDVVTPIVTQHSKVNDSNELGGLTTSGSAE