McDonnell Genome Institute

Washington University

CircRNA

chr1|35408007|35415714|+|ZMYM4|ENST00000314607.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9036

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

5

Peptide

QESEPVR

Amino Acids from 5' Exons

SALSSRKTFCPALLLSVWAYASLSKRCGDQMVKNMIQTVSYTCALEFN,PLYQAEGRHSVLHFCVEFGLMPVYPRGAETKWKISRQYLILVPWNST,RSIKLKEDILSCTFAELSLGLCQFIQEVRRPNGEKYDPDSILYLCLGIQQ

Amino Acids from 3' Exons

VTCSLALRKSICGSANSWALTHQSSFTPSFSSIPNTSNRMLLSTSFPLPMDGPGLSTVPRHIGSSHLYRSRSQNQ,LHVLSHGRAFVGVQTAGRLLTNRPFKHPPFLQYQILPTKECYALEAFLCPCDETDQDSEVQYQDDISEVLPTFTEAGVRT,YMFSRIEEEHLWECKQLGAYSPIVLLNTLLFFNTKYFQLKNVTEHLKLSFAHVMRRTRTLKYSTKMTYLRFFPPLQKQESEP