McDonnell Genome Institute

Washington University

CircRNA

chr1|35095818|35097566|+|ZMYM1|ENST00000359858.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9336

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

4

Peptide

SIVIGNSPELRR

Amino Acids from 5' Exons

EYCHRQQSRTQENELKINAVFSES,SIVIGNSPELRRMNKMLCFQRV,VLSATVQNSGETENKCCVFRE

Amino Acids from 3' Exons

LHSLQAFSFLWHHLAIKCFLQFQPQLFRFPVLVVKKFSRRGKLLIRGKDLLNFSAPYHASLNTFHLPVHQFLLRELVQTAQ,FTVDCRHSAFSGIIWRENASFSFNHSYSGFLCWLKNSPEGANCLSEERICSTFLLHTMHHIHFICQFTSSFENLFKLLK,SQLTAGIQLSLASSGVNKMLPSVSTTAIQVSCAGCKKILQKGQTAYQRKGSAQLFCSIPCITEYISSASSPVPSKRTCSNCS