McDonnell Genome Institute

Washington University

CircRNA

chr1|33652322|33743606|-|CSMD2|ENST00000241312.8

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9045

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

GLWQPPPLCLAHPGQA

Amino Acids from 5' Exons

LPAGETQDHLESSSHQITQNPTRQARSVTGKPSHQTTSSPWYLT,SLRGRPDRTIWSHPLTKLPRTLPARQGVLESDRLTRLRHRPGIH,PCGGDLTGPSGVILSPNYPEPYPPGKECDWKVTVSPDYVIALVFN

Amino Acids from 3' Exons

SPASSTSPARLGLSCLPTTQRTMATTSTVSGSSWPGLRAASTWPSTTLTWSLSLISWSSRMGPPPRRPSWAPSQETSFPPPSQAVATWPVSSSRLTTPQGRGASTSLLP,LLLLQLHQPVWGCPVSQLPRGLWQPPPLCLAHPGQAEPHPPGLQRHRGASVFPGHQGWGHRRGARPGHLLRKPASLLHHKQWPRGPSRVPDPLHREEGLQHHFY,SCFFNFTSPSGVVLSPNYPEDYGNHLHCVWLILARPESRIHLAFNDIDVEPQFDFLVIKDGATAEAPVLGTFSGNQLPSSITSSGHVARLEFQTDHSTGKRGFNITFT