McDonnell Genome Institute

Washington University

CircRNA

chr1|32226170|32231019|+|EIF3I|ENST00000373586.1

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9021

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

VTLDLSTVLPSILMAR

Amino Acids from 5' Exons

ESSWPFSRPIRLSGPAVLTLGATSSCSPRTSRWATSALAFLTCGIRARL,KAAGPSQDQFGCPDLRFLWGQHHHVLHGQADGLPVLCELFPAGSEPD,KQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQI

Amino Acids from 3' Exons

VLPFGLRRVWKSQGSLWTYQQCCLPSWQE,FFHLAFEEEFGRVKGHFGPINSVAFHPDGK,SSIWPLKKSLEESRVTLDLSTVLPSILMAR