McDonnell Genome Institute

Washington University

CircRNA

chr1|30950132|30995220|-|PUM1|ENST00000257075.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9176

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

ALEFIPSDQQGPR

Amino Acids from 5' Exons

FGSLEQKLALAERIRGHVLSLALQMYGCRVIQKALEFIPSDQQ,LAVLNRSWLWQNGFEATSCHWHYRCMAAVLSRKLLSLFLQTS,WQSTEAGFGRTDSRPRPVIGTTDVWLPCYPESSVYSFRPA

Amino Acids from 3' Exons

GPRDADSDENDKGEKKNKGTFDGDKLGDLKEEGDVMDKTNGLPVQNGIDADVKDF,AQGMQTVMKTTKVKRRTRVRLMEISEIRRRVMWTRPMVYQCRMGLMQTSKIL,PKGCRQKRQRKEEQGYVWRARRFEGGGCDGQDQWFTSAEWDCRRQRF