McDonnell Genome Institute

Washington University

CircRNA

chr1|30945345|30950261|-|PUM1|ENST00000373741.8

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9755

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

7

Peptide

GQFGSLEQK

Amino Acids from 5' Exons

NEMVRELDGHVLKCVKDQNGNHVVQKCIECVQPQSLQFIIDAFKGQ,MRWFGNMAMSSVKIRMAITWFRNALNVYSPSLCNLSSMRLRD,DGSGTRWPCLEVCERSEWQSRGSEMHMCTAPVFAIYHRCVGT

Amino Acids from 3' Exons

FGSLEQKLALAERIRGHVLSLALQMYGCRVIQKALEFIPSDQQVI,LAVLNRSWLWQNGFEATSCHWHYRCMAAVLSRKLLSLFLQTSR,WQSTEAGFGRTDSRPRPVIGTTDVWLPCYPESSVYSFRPAGN