McDonnell Genome Institute

Washington University

CircRNA

chr1|29033092|29039426|+|EPB41|ENST00000343067.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9774

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

4

Peptide

SLDGGLGR

Amino Acids from 5' Exons

DLEGVDIILGVCSSGLLVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGE,TWKEISSVSALVAFWFTKISELTASLGPKCRFLINVVAFSSRFGLE,LGRSRYHPRCLLWPSGLQRAENPLPLAQSAEDFLTLFHQDSAWR

Amino Acids from 3' Exons

IDIYRHHSQKQISCARIQISIQWPDSSSDQASCSNQACPTLRAYSKTGVPEPRW,LTSTDTIPKSKFLALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRASRSLDG,HLQTPFPKANFLRDPNFDTVAGLKLRPGKLVLLTGLPHTSSVQQVNGRPGASME