McDonnell Genome Institute

Washington University

CircRNA

chr1|29018223|29065158|+|EPB41|ENST00000343067.8

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9221

17

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

2

Peptide

TSALFLCNLSIIR

Amino Acids from 5' Exons

ILFMSSASAGHSCRTSALFLCNLSIIRFLHHPVTGRLRPRTPWRGLCFTGPESDQGTREGHGTAVIQ,YYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYVSDFKLAPNQTKELEEKVMELHKSY,IIYVFSFGRTLQDVCPVPLQPHYVLTPSSLNWETTTQNSMAWIMLVILNWPRIRPRNLKRRSWNCISHT

Amino Acids from 3' Exons

DLDKSQEEIKKHHASISELKKNFMESVPEPRPSEWDKRLSTHSPFRTLNINGQIPTGEG,ITRVKRRSKNIMPASVSKRTSWSLYQNHGLVNGINAYPLTHPSELLTSMGKSPQEK,FRQESRGDQKTSCQHQAEKELHGVCTRTTAMGTLIHSLTLPNSHQWANPHRRR