McDonnell Genome Institute

Washington University

CircRNA

chr1|28987430|29097935|+|EPB41|ENST00000343067.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9489

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

22

2

Peptide

LPSNIMTTEKSLVTEAENSQHQQK

Amino Acids from 5' Exons

QHHDNREEFSDGRKFTAPTEGRGGSHKLRPTRTSAGGILSNSSRRLVTEAESFWRHSYTRLDQEQGADIRKQRTFTTILLVSQKAQISGVRGRRQRSRVRRKRRRSERDRIWNQSRDHFKGPNCSSTGTQNRPIFGSSFIKQCRNT,NIMTTEKSLVTEAENSQHQQKEEGEEAINSGQQEPQQEESCQTAAEGDNWCEQKLKASNGDTPTHEDLTKNKERTSESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQ,TSQQRRVLRPKIHSTNRRKRVRKPTQANKNLSRRNLVKQQLKEIIGVNRSKLLMETLLHMKTPRTRSGHQKAEDFHDYSPRFSKGPNLRCPRKKAKKSQIKKKVKEVRKRNLEPVLMKRSFRPQLQLLNRNSKQTHLWIFIHAVQKH

Amino Acids from 3' Exons

PPLVKTQTVTISDNANAVKSEIPTKDVPIVHTETKTITYEAAQ,LPWRHKLSPSQIMPMLKVKSQPKTSLLSTLRPRPSLMRLP,SPGEDTNCHHLRCQCCEKNPNQRRPYCPHDQDHHLGCP