McDonnell Genome Institute

Washington University

CircRNA

chr1|28987430|29011907|+|EPB41|ENST00000343067.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9306

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

4

Peptide

KAGSCNIMTTEK

Amino Acids from 5' Exons

QHHDNREEFSDGRKFTAPTEGRGGSHKLRPTRTSAGGILSNSSRRLVTEAESFWRHSYTRLDQEQGADIRKQRTFTTILLVSQKAQISGVRGRRQRSRVRRKRRRSERDRIWNQSRDHFKGPNCSSTGTQNRPIFGSSFIKQCRNT,NIMTTEKSLVTEAENSQHQQKEEGEEAINSGQQEPQQEESCQTAAEGDNWCEQKLKASNGDTPTHEDLTKNKERTSESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQ,TSQQRRVLRPKIHSTNRRKRVRKPTQANKNLSRRNLVKQQLKEIIGVNRSKLLMETLLHMKTPRTRSGHQKAEDFHDYSPRFSKGPNLRCPRKKAKKSQIKKKVKEVRKRNLEPVLMKRSFRPQLQLLNRNSKQTHLWIFIHAVQKH

Amino Acids from 3' Exons

TWLDSAKEIKKQVR,HGWIPPKKKSRFV,MAGFRQRNKKAGS