McDonnell Genome Institute

Washington University

CircRNA

chr1|28516724|28531990|+|RCC1|ENST00000434290.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9777

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

NFTVHHPK

Amino Acids from 5' Exons

LHECVRSWRKTAEREREIRDPRVKSWRNFTVHHPKEESMMEAE,YMNVDLGGRQQRERERSEIPGLKVGEISQYIIQKRSPWRQ,TMCKILEEDSRERERDQRSQGKLEKFHSTSSKRGVHDGGR

Amino Acids from 3' Exons

SHTGPTAQNPAWCHARATWASWGWVRMWRGRSRPWYPFRRMLCRLRLGACTPCVAKVA,LTQVPQHRTRLGADTRPGRRGPAGAGECDGEEEAGPGIHSGGCCAGGWGHAHRVSKQKWP,SHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQ