McDonnell Genome Institute

Washington University

CircRNA

chr1|28459084|28474151|+|PHACTR4|ENST00000373836.4

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9792

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

LWQDLQALEMEEK

Amino Acids from 5' Exons

RKQTSPLQSQAWSWTVWKQETQHLLPKGRASSQALARSSSPGNGGKKKVVINLKRLQK,GSRPAHYRARHGPGQCGSRRHNTSYQKEEQVLRLWQDLQALEMEEKKKIRDFR,EADQPTTEPGMVLDSVEAGDTTPPTKRKSKFSGFGKIFKPWKWRKKKSSDKFKETSE

Amino Acids from 3' Exons

LNCPKQTVVHCYQNRPHPYHLREAFHQPQYPPWSLLLPSPQKHQVMKERRARVLWARNYYQSHLALRPPHCLLIYLQSLHAPLHSLLRLFKLCQKLSFHHPIYTRRFPSRKIRKRKSPRGYWTRTLGSPIYPLGCLHSHCIFESSRPSPAHFPLLFWRVLTELIRCFLKTVTAFLRTAVRWVGPGLFPSLLKCK,TVPSNKQWYIVIKTVPTLTTERHSINLSTHLGVCCCHHHKNTKKREEHVFYGLGTTTNDLTSLSVPPTAYSYTSRASTHPSIPCDFSSCARNVSTILRSTPGDSPAGRSEKGSPQEDTGPELWGAPYTLAASTPTAYSNPAGPHQPTSHDSYSGGFSQSSFVAFKQQLFGQQYAGSDQVSSHHYNAKS,ELSQAINSGTLLSKPSPPLPPKRGIPSTSVPTLESAAAITTKTPSDEREKSTCSMGSELLPMISPRSPSPPLPTHIPPEPPRTPPFPAKTFQVVPEIEFPPSLDLHQEIPQQEDQKKEVPKRILDQNFGEPHIPSRLPPLPLHIRIQQALTSPLPMTPILEGSHRAHSLLFENSDSFSEDSSTLGRTRSLPITIEMLK