McDonnell Genome Institute

Washington University

CircRNA

chr1|26257596|26269614|+|CEP85|ENST00000252992.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9157

100

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

9

Peptide

EAEFSSAGHSFR

Amino Acids from 5' Exons

LQNGAICHHPAAFGPSLPILEPAQWISILNSNEHLLKEKELLID,FRMEPSATILLLLVLHCPSSQHSGSASTVMNTFRKKSFSLT,SEWSHLPPSCCFWSFTAHLRASTVDQHLEQTPSEGKRASHQ

Amino Acids from 3' Exons

LKDSELKSTELQEKVTELESLLEETQAICREKEIQLESLRQREAEFSSAGH,LRILSRAQSCRRKLSWRVCWRRPRQSAERRRFNWKAGREKQNSPPLDI,GFVEEHRAAGESDAGEFAGGDPGNLQREGDSTGKPEAERSRILLRWT