McDonnell Genome Institute

Washington University

CircRNA

chr1|26255170|26255865|+|CEP85|ENST00000252992.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9826

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

15

Peptide

LQMEQMQIFAAQVAVLLSSPSK

Amino Acids from 5' Exons

IFAAQVAVLLSSPSKATPFQQPMCLLLGPLLPSQILHLLDPLPLNSLCQGWLKVWEQEMETSVQNILQAYLEISCISLVLLEKMELSSPGFQQWAMKDKKRRGSLIFLAWNLPSISRQWRHFIQILTTESASTTQEPAQVRSCTECCLRPRRHRAAGQCLSGMDHILIAVGSSLWDSSLLPGSPSLCPLRCGSRVLTLGIPESNLVNSALVGSSWNFVYRWSKC,FLQLKWQSSFPAHQKPRNHSNSPCDAFYFRDLSCQAKFYTCWTLFLTPFVRVGKCGNDKKWRPRCNETFSRPIRSHVFLWCYWRKWNAVLVSSSGPKTRRGEEVYSHGIYPQSVGNDGDTLFRSSPPSPLPQPKNQHKGVVQSVAGQEGTGQRGSVAEWTTFQWGPPFGTPACSRALQASALSGVAAESHLASPRAILTQHLSAAAGIDSFTDGANA,FCSSSGSPPFQPIKSHVTIPTAHVMPSTLGTSPAKPNSTPVGPSSSKLPLSGLAESVGMTRNGDLGAMKHSPGLSRDLMYFSGATGENGIEQSWFPAVGHERQEEARKFDIPSMESTLNQSAMMETLYSDPHHRVRFHNPRTSTSKELYRVLPEAKKAPGSGAVFERNGPHSNSSGVLPLGLQPAPGLSKPLPSQVWQPSPDTWHPREQSCELSTCRQQLELIRLQMEQMQ

Amino Acids from 3' Exons

IFAAQVAVLLSSPSKATPFQQPMCLLLGPLLPSQILHLLDPLPLNSLCQGWLKVWEQEMETSVQNILQAYLEISCISLVLLEKMELSSPGFQQWAMKDKKRRGSLIFLAWNLPSISRQWRHFIQILTTESASTTQEPAQVRSCTECCLRPRRHRAAGQCLSGMDHILIAVGSSLWDSSLLPGSPSLCPLRCGSRVLTLGIPESNLVNSALVGSSWNFVYRWSKC,FLQLKWQSSFPAHQKPRNHSNSPCDAFYFRDLSCQAKFYTCWTLFLTPFVRVGKCGNDKKWRPRCNETFSRPIRSHVFLWCYWRKWNAVLVSSSGPKTRRGEEVYSHGIYPQSVGNDGDTLFRSSPPSPLPQPKNQHKGVVQSVAGQEGTGQRGSVAEWTTFQWGPPFGTPACSRALQASALSGVAAESHLASPRAILTQHLSAAAGIDSFTDGANA,FCSSSGSPPFQPIKSHVTIPTAHVMPSTLGTSPAKPNSTPVGPSSSKLPLSGLAESVGMTRNGDLGAMKHSPGLSRDLMYFSGATGENGIEQSWFPAVGHERQEEARKFDIPSMESTLNQSAMMETLYSDPHHRVRFHNPRTSTSKELYRVLPEAKKAPGSGAVFERNGPHSNSSGVLPLGLQPAPGLSKPLPSQVWQPSPDTWHPREQSCELSTCRQQLELIRLQMEQMQ