McDonnell Genome Institute

Washington University

CircRNA

chr1|25801042|25805275|+|SEPN1|ENST00000354177.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9941

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

5

Peptide

DGFLGELALK

Amino Acids from 5' Exons

ELALKTLGTDGLFLFSSLDTDGDMYISPEEFKPIAEKLT,NWRRPWGQMAFFSFPPWTLTGICTSALRSSNPLLRSQ,TGAEDPGDRWPFSLFLLGHRGYVHQPGVQTHCEAN

Amino Acids from 3' Exons

GQLPRPAARRRSCPLTLARRRSPKPDSSLCSRRPPRAKMAS,VNSRGQLRGGGVAPPRGDAHHRSPIPASAPGDHDQEQRWLPR,STPAASCEEEELPPDPSEETLTIEARFQPLLPETMTKSKDGFLG