McDonnell Genome Institute

Washington University

CircRNA

chr1|25458390|25491584|+|TMEM57|ENST00000374343.4

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9959

31

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

6

Peptide

QLEIAQAAK

Amino Acids from 5' Exons

QPKDYLIWILRSLYTTMEVSQPTKNSPQLCQRNTEKKGKKRTRMPKNTTLEITTIFYNLTLKYKRLSIWKTISIVKDIMILWEVQKISKRTHALLPQKITKMPVELTLHLEVIAPQMGAFLPHLVKMRRSRNALARAQVHTRTWKTVFLITSANQTHWS,SQRITYGFFDPYTPQWRYPSQQKTLHNFARDRIPRKRERKGQGCQKTQPWNKQQYSTTCRLNTRDVYGKPYQKIKSCGKYRKSLERGLMHCFLKKLQKCQWSCELFTSKSRHKWEHSFLIKEEAEMHQEPKYTQGLNGKLYSPAKQTRRTGQ,AKGLPDMDSSILIHHNGGIPANKKLSTTLPEIEYREKGKEKDKDAKKHNLGINNNNILQPVDSKIQEIEYMENHINSKRLNNDLVGSTENLLKEDSCTASSKNYKNASGVVNSSPRSHSATNGSIPSSSSKNEKKQKCTSKSPSTHKDLMENCIPNNQLSKPDALV

Amino Acids from 3' Exons

ELRKYKENEKDTEVLMSALSAMQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQ,SFGNIRKMRRTLRCCQPSQPCKTKHSTWRTAVQRRESSWTCSPHWAMQSGSSRLPK,ASEIGKEGHGVNVSPLSHARQNTAPGEQLKCRDENQAGPVLRTGRCKAAARDCP