McDonnell Genome Institute

Washington University

CircRNA

chr1|248824752|248825366|-|SH3BP5L|ENST00000366472.5

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9994

22

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

SLGAQSQK

Amino Acids from 5' Exons

LPRDAHPTASARAQPSLSSCHHSLEAPASTLPNGAPPSRPRSRIQAPFAPCLGAVAPGLSQWTPCGGKGRTFAQTRLQLEPHQLESQPLTCEVLPVPTFSAFEEKLFSWPSRAQEAPSWGPGPSMSVLSCAGSALPLSAWLSSDRFQEGGRPHRGSCGLKLRMKSLGAQSQKSLEEVEAAAVRPNCPQERRKNWILEY,SPETLILQPQLGPSLLSPAATTAWRRLPPPSRMVLLLAGLGPGSKPPLPPALELLLRVCHSGLPVAGREELLHRQGFSSRNPTDNLNLNLPSVRFFLCPPFLPFEKRNSSPGHLEPRKPQAGALVPACQSSLVHRALPSPCQHGAQTGSRRAGDPTGGAAASCRGSPEPSRRRAWRRWKQQQGQIVPKRGGRTGSNT,PQRRSSYSLSSGPAFSLQLPPQPGGACLHPPEWCSSQASVQDPSPLCPLPWSCCSGFVTVDSLWREGKNFCTDKASALGTPLTTISTSNLVGSSCAHLFCLLRRETLLLAISPGSPKLGPWSQHVSPLLCIGLCPPPVSMAELRQVPGGRETPQGELRPEVVEDEVPRSPVAEEPGGGGSSSSEAKLSPREEEELDPRIQ

Amino Acids from 3' Exons

LPRDAHPTASARAQPSLSSCHHSLEAPASTLPNGAPPSRPRSRIQAPFAPCLGAVAPGLSQWTPCGGKGRTFAQTRLQLEPHQLESQPLTCEVLPVPTFSAFEEKLFSWPSRAQEAPSWGPGPSMSVLSCAGSALPLSAWLSSDRFQEGGRPHRGSCGLKLRMKSLGAQSQKSLEEVEAAAVRPNCPQERRKNWILEY,SPETLILQPQLGPSLLSPAATTAWRRLPPPSRMVLLLAGLGPGSKPPLPPALELLLRVCHSGLPVAGREELLHRQGFSSRNPTDNLNLNLPSVRFFLCPPFLPFEKRNSSPGHLEPRKPQAGALVPACQSSLVHRALPSPCQHGAQTGSRRAGDPTGGAAASCRGSPEPSRRRAWRRWKQQQGQIVPKRGGRTGSNT,PQRRSSYSLSSGPAFSLQLPPQPGGACLHPPEWCSSQASVQDPSPLCPLPWSCCSGFVTVDSLWREGKNFCTDKASALGTPLTTISTSNLVGSSCAHLFCLLRRETLLLAISPGSPKLGPWSQHVSPLLCIGLCPPPVSMAELRQVPGGRETPQGELRPEVVEDEVPRSPVAEEPGGGGSSSSEAKLSPREEEELDPRIQ