McDonnell Genome Institute

Washington University

CircRNA

chr1|246633923|246648037|+|CNST|ENST00000366513.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9316

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

5

Peptide

IEIAEMR

Amino Acids from 5' Exons

MRKQNSFSNDCIMSNCSQIFLPFKNSG,ESNEIHSARTIVSAIARKSFCHSRTV,EKAMKFIQLERLYHEQLLANLSAIQEQW

Amino Acids from 3' Exons

RVKLVSAQSQVKKANIQWSPWGAVPAVIRWTCKQIPQAFRLQERTTWRSCSAALKPRRSTPSPPRQQGARLGQTLLRMLVRMTVACSWLKQRPARMWPERALLKTLRCFFPASQRQSRFHQAVTVYLLHFLRVNIHRLRGKNSVCHFGMLLRRCPQTNLRTMNMSCSSLILQTVMENHHRRRLTQTVLRMCSVEIIKYLTAYCFQRCVWPQRKREIKTTNSTKKQKTITAFKDVKILKIPFPMKITKTTTPISFKISLLKKHPIVSRRICLLMRAVFLLMILPKGRLQ,ENLSRHRVKRKPTYSGAPGEQSLLSSDGRANRFPKPFGNCRKGPHGGAALQRSHVSAPHPVLRDSREPVWARLFGCLGQSLAAGSNRGLPGCGQNRGHCRPGVSFQQVKDRAVDFTRLPYTSCIDFGIFTGSEERTPFATSGCFGVAHRPTEQIKAAAASYRQWKITTGAGLRRFECALWKSNILRHTASRGVYGPRGKGRRRPTQQRNRRLFEQPFRRMFKRYRFPFLRPRRRLRSPSRSLSRSILSPGESAFELSFSSCQKDRDCR,SKTCLGTESSKESQHTVEPLGSSPCCHQMDVQTDSPSLSVTAGKDHMEELLCSAEATLALHTQSSETAGSPSGPDSSEDACEDDSRLQLAQTEACQDVARIEGIAEDPKVFLSSKSKTEPLISPGCDRIPPALISEGKYSQAQRKELRLPLRDASEALPTDQLENNELNELQQPDLTDSDGKSPQAQADSDGSENVLCGNNQISDLGILLPEVCMAPEEKGDKDDQLNKETEDYLNSLLEGCLKDTEDSLSYEDNQDDDSDLLQDLSPEEASYSLQENLPSDESCLSLDDLAKRIEIAE