McDonnell Genome Institute

Washington University

CircRNA

chr1|246621428|246634587|+|CNST|ENST00000366512.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9972

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

7

Peptide

KFVQHIKR

Amino Acids from 5' Exons

DFFQEILHLCKKKYAQSHMLLMMKKLLKMLMSSQRRQSLFCSLCFHLYEVKLSSWIQEHFPFAFI,TFFRRYCTFNARKSTKRSHICCRSCSKCAARGAKACSAVSVFTYTRSAVGFKSTSPLPSS,LFSGDIAPLMQEKVLSAVTYAVDDEEAAEVNANEQPEAPKLVLQSLFSLIRGEVEQLDSRALPLCLHQ

Amino Acids from 3' Exons

KQNGKLCNHIQLRLGIQKRDLMVKILNGLRKFVQHIK,NKMENCATTYSYGSKEFRKGIWRFTAYENLCNTSR,TKWKTVQPHTVTALRNSEKGFNGEDFERLTKICATHQ